PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco019039.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family MIKC_MADS
Protein Properties Length: 210aa    MW: 23137.6 Da    PI: 10.3109
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco019039.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF58.39.9e-1988124238
                  ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEE CS
       SRF-TF   2 rienksnrqvtfskRrngilKKAeELSvLCdaevavi 38 
                  rie+k  rqv fskRr+g++KKA EL vLCdaev ++
  Aco019039.1  88 RIEDKASRQVCFSKRRAGLMKKARELAVLCDAEVGLV 124
                  8*********************************987 PP

2K-box35.93.2e-131372032995
        K-box  29 enLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 
                  e L+ +qR l   ++ +Ls+ eL+q+e++L+ +l++  ++K+++++++i elq+k ++l e+ + L+
  Aco019039.1 137 ELLEFSQRSLDKSNIAQLSFDELNQVESELDGALTQTIARKTQVMMDMIAELQEKGEKLLEKRRVLQ 203
                  6788889999999**********************************************99998886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006623.36679124IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.16E-1979127IPR002100Transcription factor, MADS-box
SMARTSM004321.8E-2079132IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-1581101IPR002100Transcription factor, MADS-box
PfamPF003191.7E-1988124IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-15101116IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-15116137IPR002100Transcription factor, MADS-box
PROSITE profilePS512977.748122209IPR002487Transcription factor, K-box
PfamPF014861.1E-9137203IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MRSMATRTSS RPLPHHPFSP FAIPERERER GHRSIDRSID TSIDVALQIP SSPASASSSS  60
SFVGAGIRVL WGSGKGAAMV RGRVELRRIE DKASRQVCFS KRRAGLMKKA RELAVLCDAE  120
VGLVGTKGFA CPRTKDELLE FSQRSLDKSN IAQLSFDELN QVESELDGAL TQTIARKTQV  180
MMDMIAELQE KGEKLLEKRR VLQSVSCFS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008810236.14e-52PREDICTED: truncated transcription factor CAULIFLOWER A-like isoform X2
SwissprotQ6EU395e-25MADS6_ORYSJ; MADS-box transcription factor 6
TrEMBLA0A061EEK27e-25A0A061EEK2_THECC; MADS-domain protein, putative
TrEMBLM0TUC57e-25M0TUC5_MUSAM; Uncharacterized protein
TrEMBLQ58A822e-24Q58A82_GINBI; MADS-box transcription factor GbMADS1
STRINGGSMUA_Achr8P28220_0012e-24(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2887322
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45650.17e-21AGAMOUS-like 6